You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb326336 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to LAMTOR3 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human LAMTOR3 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 13kDa |
Target | LAMTOR3 |
UniProt ID | Q9UHA4 |
Protein Sequence | Synthetic peptide located within the following region: LPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSK |
NCBI | NP_068805 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti MAP2K1IP1 antibody, anti MAPBP antibody, anti Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: LAMTOR3, Sample Type: 293T Whole Cell lysates, Antibody Dilution: 1.0 ug/mL, LAMTOR3 is supported by BioGPS gene expression data to be expressed in HEK293T.
ELISA, IF, IHC-P, WB | |
Bovine, Gallus | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating