You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb402210 |
---|---|
Category | Antibodies |
Description | L1CAM Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence of human L1CAM (NMVITWKPLRWMDWNAPQVQYRVQWRPQGTRGPW). |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
UniProt ID | P32004 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Neural cell adhesion molecule L1; N-CAM-L1; NCAM-L Read more... |
Note | For research use only |
Application notes | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
IHC analysis of L1CAM using anti-L1CAM antibody.L1CAM was detected in paraffin-embedded section of mouse brain tissue.
IHC analysis of L1CAM using anti-L1CAM antibody.L1CAM was detected in paraffin-embedded section of mouse brain tissue.
IHC analysis of L1CAM using anti-L1CAM antibody.L1CAM was detected in paraffin-embedded section of rat brain tissue.
IHC analysis of L1CAM using anti-L1CAM antibody.L1CAM was detected in paraffin-embedded section of human colon cancer tissue.
IHC analysis of L1CAM using anti-L1CAM antibody.L1CAM was detected in paraffin-embedded section of human glioma tissue.
IHC analysis of L1CAM using anti-L1CAM antibody.L1CAM was detected in paraffin-embedded section of human lung cancer tissue.
IHC analysis of L1CAM using anti-L1CAM antibody.L1CAM was detected in paraffin-embedded section of human mammary cancer tissue.
IF, IH, WB | |
Human, Mouse, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating