Cart summary

You have no items in your shopping cart.

    KRT19 Antibody - N-terminal region : FITC

    KRT19 Antibody - N-terminal region : FITC

    Catalog Number: orb2115666

    DispatchUsually dispatched within 5-10 working days
    $ 632.00
    Catalog Numberorb2115666
    CategoryAntibodies
    DescriptionKRT19 Antibody - N-terminal region : FITC
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsIHC, WB
    ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human KRT19
    Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
    ConjugationFITC
    MW44kDa
    UniProt IDP08727
    Protein SequenceSynthetic peptide located within the following region: TSYSYRQSSATSSFGGLGGGSVRFGPGVAFRAPSIHGGSGGRGVSVSSAR
    NCBINP_002267
    StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
    Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
    Alternative namesK19, CK19, K1CS
    Read more...
    NoteFor research use only
    Expiration Date12 months from date of receipt.
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars