You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb582745 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to KRAS |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Yeast, Zebrafish |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human KRAS |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 22 kDa |
Target | KRAS |
UniProt ID | P01111 |
Protein Sequence | Synthetic peptide located within the following region: TEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETC |
NCBI | NP_203524 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | NS, NS3, OES, CFC2, RALD, K-Ras, KRAS1, KRAS2, RAS Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/ml of the antibody was used in this experiment.
Host: Mouse, Target Name: KRAS, Sample Tissue: Mouse Kidney, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target: KRAS, Positive control (+): Human stomach (ST), Negative control (-): Human liver (LI), Antibody concentration: 3 ug/ml.
WB Suggested Anti-KRAS Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human heart.
FC, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating