KPNA3 antibody

• Catalog Number: orb582431
• Category: Antibodies
• Description: Rabbit polyclonal antibody to KPNA3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KPNA3
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 58kDa
• Target: KPNA3
• UniProt ID: O00505
• Protein Sequence: Synthetic peptide located within the following region: AENPSLENHRIKSFKNKGRDVETMRRHRNEVTVELRKNKRDEHLLKKRNV
• NCBI: NP_002258
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: SRP1, SRP4, IPOA4, hSRP1, SRP1gamma
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: KPNA3, Sample Type: Hela, Antibody dilution: 1.0 ug/ml. KPNA3 is supported by BioGPS gene expression data to be expressed in HeLa.

Host: Rabbit, Target Name: KPNA3, Sample Type: HepG2, Antibody dilution: 1.0 ug/ml. KPNA3 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.

Host: Rabbit, Target Name: KPNA3, Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: KPNA3, Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

WB Suggested Anti-KPNA3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: MCF7 cell lysate. KPNA3 is strongly supported by BioGPS gene expression data to be expressed in MCF7.