KMT2B antibody

• Catalog Number: orb324492
• Category: Antibodies
• Description: Rabbit polyclonal antibody to KMT2B
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MLL4
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 64kDa
• Target: KMT2B
• UniProt ID: Q9UMN6
• Protein Sequence: Synthetic peptide located within the following region: WAGPRVQRGRGRGRGRGWGPSRGCVPEEESSDGESDEEEFQGFHSDEDVA
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti HRX2 antibody, anti MLL2 antibody, anti TRX2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: MLL4, Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 1 ug/mL.

WB Suggested Anti-MLL4 Antibody Titration: 5 ug/mL, Positive Control: HepG2 cell lysate, KMT2B is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.