You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb573770 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to KLF9 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit |
Reactivity | Human, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human KLF9 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 27kDa |
Target | KLF9 |
UniProt ID | Q13886 |
Protein Sequence | Synthetic peptide located within the following region: LPEREVTKEHGDPGDTWKDYCTLVTIAKSLLDLNKYRPIQTPSVCSDSLE |
NCBI | NP_001197 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | BTEB, BTEB1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: KLF9, Sample Tissue: Human 786-0, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: KLF9, Sample Tissue: Human HepG2 Whole Cell, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target Name: KLF9, Sample Type: Fetal Liver lysates, Antibody dilution: 1.0 ug/ml.
Host: Rat, Target Name: KLF9, Sample Tissue: Rat Liver, Antibody dilution: 1 ug/ml.
Rabbit Anti-KL9 Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
Testis
WB Suggested Anti-KLF9 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:1562500 Positive Control: Jurkat.
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating