You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb575563 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to KLF6 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human KLF6 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 32kDa |
Target | KLF6 |
UniProt ID | Q99612 |
Protein Sequence | Synthetic peptide located within the following region: REKKEESELKISSSPPEDTLISPSFCYNLETNSLNSDVSSESSDSSEELS |
NCBI | NP_001291 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | GBF, ZF9, BCD1, CBA1, CPBP, PAC1, ST12, COPEB Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Mouse, Target Name: KLF6, Sample Tissue: Mouse Pancreas, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target Name: KLF6, Sample Tissue: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.
WB Suggested Anti-KLF6 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Stomach.
Filter by Rating