You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb325853 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to KLB |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human KLB |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 120 kDa |
Target | KLB |
UniProt ID | Q86Z14 |
Protein Sequence | Synthetic peptide located within the following region: DAYTIRRGLFYVDFNSKQKERKPKSSAHYYKQIIRENGFSLKESTPDVQG |
NCBI | NP_783864 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti BKL antibody, anti MGC142213 antibody Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.
Host: Rabbit, Target Name: KLB, Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 1 ug/mL.
Host: Rabbit, Target Name: KLB, Sample Tissue: Human U937 Whole Cell, Antibody Dilution: 1 ug/mL.
Host: Rabbit, Target Name: KLOTB, Sample Type: 721_B Whole Cell lysates, Antibody Dilution: 0.5 ug/mL.
Human Testis
Immunohistochemistry of formalin-fixed, paraffin-embedded human colon tissue after heat-induced antigen retrieval. Antibody concentration 10 ug/mL.
Immunohistochemistry of formalin-fixed, paraffin-embedded human testis tissue after heat-induced antigen retrieval. Antibody concentration 10 ug/mL.
WB Suggested Anti-KLB Antibody Titration: 1 ug/mL, Positive Control: 721_B cell lysate.
Filter by Rating