You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579138 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to KITLG |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Porcine, Rabbit, Sheep |
Reactivity | Human, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human KITLG |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 28kDa |
Target | KITLG |
UniProt ID | P21583 |
Protein Sequence | Synthetic peptide located within the following region: TKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLHWAAMALPALFSLIIG |
NCBI | NP_000890 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | SF, MGF, SCF, SLF, DCUA, FPH2, FPHH, KL-1, Kitl, S Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: KITLG, Sample Type: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.
Host: Rabbit, Target: KITLG, Positive control (+): Human lung (LU), Negative control (-): Human brain (BR), Antibody concentration: 1 ug/ml.
Host: Rat, Target Name: KITLG, Sample Tissue: Rat Skeletal Muscle, Antibody Dilution: 1 ug/ml.
WB Suggested Anti-KITLG Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: HepG2 cell lysate.
ELISA, IF, IHC-P, WB | |
Bovine | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating