You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb573897 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to KIN |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human KIN |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 45kDa |
Target | KIN |
UniProt ID | O60870 |
Protein Sequence | Synthetic peptide located within the following region: LKTIGSSASVKRKESSQSSTQSKEKKKKKSALDEIMEIEEEKKRTARTDY |
NCBI | NP_036443 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | BTCD, Rts2, KIN17 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Human kidney
Human Spermatophore
WB Suggested Anti-KIN Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:2500, Positive Control: HepG2 cell lysate, KIN is supported by BioGPS gene expression data to be expressed in HepG2.
ICC, IF, IHC-P | |
Bovine, Canine, Equine, Gallus, Guinea pig, Rabbit, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating