You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb574872 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to KIF5B |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC-P, WB |
Predicted Reactivity | Bovine, Canine, Mouse, Porcine, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human KIF5B |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 110kDa |
Target | KIF5B |
UniProt ID | P33176 |
Protein Sequence | Synthetic peptide located within the following region: CNIKVMCRFRPLNESEVNRGDKYIAKFQGEDTVVIASKPYAFDRVFQSST |
NCBI | NP_004512 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | KNS, KINH, KNS1, UKHC, HEL-S-61 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: KIF5B, Sample Tissue: Human MCF7 Whole Cell, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target: KIF5B, Positive control (+): Hela (HL), Negative control (-): Human liver (LI), Antibody concentration: 2 ug/ml.
Human Liver
KIF5B was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb574872 with 1:200 dilution. Western blot was performed using orb574872 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole Cell Lysate. Lane 2: KIF5B IP with orb574872 in HEK293 Whole Cell Lysate. Lane 3: Input of HEK293 Whole Cell Lysate.
Rabbit Anti-KIF5B antibody, Formalin Fixed Paraffin Embedded Tissue: Human Adrenal, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-KIF5B Antibody Titration: 0.2-1 ug/ml, Positive Control: Human brain.
ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
ICC, IHC-Fr, IHC-P, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Monoclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, WB | |
Bovine, Canine, Human, Mouse, Rat | |
Goat | |
Polyclonal | |
Unconjugated |
Filter by Rating