KIF5A antibody

• Catalog Number: orb329752
• Category: Antibodies
• Description: Rabbit polyclonal antibody to KIF5A
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KIF5A
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 117 kDa
• Target: KIF5A
• UniProt ID: Q12840
• Protein Sequence: Synthetic peptide located within the following region: LEESYDSLSDELAKLQAQETVHEVALKDKEPDTQDADEVKKALELQMESH
• NCBI: NP_004975
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti NKHC antibody, anti MY050 antibody, anti SPG1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Canonical 117 kDa isoform is identified, and a second isoform of 104 kDa is also present in some samples.

Rabbit Anti-KIF5A antibody, Paraffin Embedded Tissue: Human Lung cell Cellular Data: bronchiole epithelium of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

Rabbit Anti-KIF5A antibody, Paraffin Embedded Tissue: Human Lung cell Cellular Data: bronchiole epithelium of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

WB Suggested Anti-KIF5A Antibody Titration: 0.2-1 ug/mL, Positive Control: Human brain.