KIF23 antibody

• Catalog Number: orb324504
• Category: Antibodies
• Description: Rabbit polyclonal antibody to KIF23
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Porcine, Rabbit, Rat
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KIF23
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 98kDa
• Target: KIF23
• UniProt ID: Q02241
• Protein Sequence: Synthetic peptide located within the following region: VRPLGFPDQECCIEVINNTTVQLHTPEGYRLNRNGDYKETQYSFKQVFGT
• NCBI: NP_004847
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti CHO1 antibody, anti KNSL5 antibody, anti MKLP
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Mouse, Target Name: KIF23, Sample Tissue: Mouse Brain, Antibody Dilution: 1 ug/mL.

WB Suggested Anti-KIF23 Antibody Titration: 0.2-1 ug/mL, Positive Control: Jurkat cell lysate.