KDM6A antibody

• Catalog Number: orb324798
• Category: Antibodies
• Description: Rabbit polyclonal antibody to KDM6A
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human UTX
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 154kDa
• Target: KDM6A
• UniProt ID: O15550
• Protein Sequence: Synthetic peptide located within the following region: KTYIVHCQDCARKTSGNLENFVVLEQYKMEDLMQVYDQFTLAPPLPSASS
• NCBI: NP_066963
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti DKFZp686A03225 antibody, anti MGC141941 antib
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target: KDM6A, Positive control (+): Human Ovary (OV), Negative control (-): Human liver (LI), Antibody concentration: 1 ug/mL.

WB Suggested Anti-UTX Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: MCF7 cell lysate, KDM6A is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells.