You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb381075 |
---|---|
Category | Antibodies |
Description | KDM5B/PLU1/Jarid1B Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, ICC, IF, IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Hamster, Rabbit |
Reactivity | Human, Monkey, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human KDM5B (641-685aa DVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFE LL), identical to the related mouse and rat sequences. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 175658 MW |
UniProt ID | Q9UGL1 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Lysine-specific demethylase 5B;1.14.11.-;Cancer/te Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of U20S cells using anti-KDM5B antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
WB analysis of KDM5B using anti-KDM5B antibody.Lane 1:monkey COS-7 cell; 2:human SH-SY5Y cell; 3:rat testis tissue; 4:mouse testis tissue.
IF analysis of KDM5B using anti-KDM5B antibody. KDM5B was detected in immunocytochemical section of MCF-7 cells.
IHC analysis of KDM5B using anti-KDM5B antibody. KDM5B was detected in paraffin-embedded section of human intestinal cancer tissue.
IHC analysis of KDM5B using anti-KDM5B antibody. KDM5B was detected in paraffin-embedded section of human intestinal cancer tissue.
IHC analysis of KDM5B using anti-KDM5B antibody. KDM5B was detected in paraffin-embedded section of human lung cancer tissue.
IHC analysis of KDM5B using anti-KDM5B antibody. KDM5B was detected in paraffin-embedded section of human breast cancer tissue.
IHC analysis of KDM5B using anti-KDM5B antibody. KDM5B was detected in paraffin-embedded section of mouse testis tissue.
IHC analysis of KDM5B using anti-KDM5B antibody. KDM5B was detected in paraffin-embedded section of rat testis tissue.
Filter by Rating