You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb575496 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to KCNQ2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish |
Reactivity | Hamster, Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human KCNQ2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 44kDa |
Target | KCNQ2 |
UniProt ID | Q53Y30 |
Protein Sequence | Synthetic peptide located within the following region: IDIMVLIASIAVLAAGSQGNVFATSALRSLRFLQILRMIRMDRRGGTWKL |
NCBI | NP_742107 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | EBN, BFNC, DEE7, EBN1, ENB1, HNSPC, KV7.2, KCNA11 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Mouse, Target Name: KCNQ2, Sample Tissue: Mouse Pancreas, Antibody dilution: 1 ug/ml.
Immunohistochemistry with Brain, cortex tissue at an antibody concentration of 5 ug/ml using anti-KCNQ2 antibody (orb575496).
Lanes: 100 ug CHO cell lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Goat anti-rabbit HRP, Secondary Antibody dilution: 1:25000, Gene Name: KCNQ2.
WB Suggested Anti-KCNQ2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate.
ELISA, FC, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Canine, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating