KCNQ1 antibody

• Catalog Number: orb329798
• Category: Antibodies
• Description: Rabbit polyclonal antibody to KCNQ1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Reactivity: Hamster, Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KCNQ1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 75 kDa
• Target: KCNQ1
• UniProt ID: P51787
• Protein Sequence: Synthetic peptide located within the following region: RSKYVGLWGRLRFARKPISIIDLIVVVASMVVLCVGSKGQVFATSAIRGI
• NCBI: NP_861462
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti ATFB1 antibody, anti FLJ26167 antibody, anti
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Mouse, Target Name: KCNQ1, Sample Tissue: Mouse Brain, Antibody Dilution: 1 ug/mL.

Kidney

Lanes: 100 ug CHO cell lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Goat anti-rabbit HRP, Secondary Antibody Dilution: 1:25000, Gene Name: KCNQ1.

WB Suggested Anti-KCNQ1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Human Liver.