You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb575441 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to KCNJ12 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rat |
Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human KCNJ12 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 49kDa |
Target | KCNJ12 |
UniProt ID | Q14500 |
Protein Sequence | Synthetic peptide located within the following region: KDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQAR |
NCBI | NP_066292 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | IRK2, hIRK, IRK-2, hIRK1, KCNJN1, Kir2.2, Kir2.2v, Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 0.1 ug/ml of the antibody was used in this experiment.
Host: Rabbit, Target Name: KCNJ12, Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: KCNJ12, Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: KCNJ12, Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: KCNJ12, Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: KCNJ12, Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: KCNJ12, Sample Type: Human Fetal Muscle, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: KCNJ12, Sample Type: Human Fetal Pancreas, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: KCNJ12, Sample Type: Human Fetal Stomach, Antibody dilution: 1.0 ug/ml.
Rabbit Anti-KCNJ12 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Adult Skeletal muscle, Observed Staining: Cytoplasm in hepatocytes, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-KCNJ12 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human brain.
Filter by Rating