You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb575390 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to KCNC4 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human KCNC4 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 64kDa |
Target | KCNC4 |
UniProt ID | Q03721 |
Protein Sequence | Synthetic peptide located within the following region: NIDRNVTEILRVGNITSVHFRREVETEPILTYIEGVCVLWFTLEFLVRIV |
NCBI | NP_720198 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | KV3.4, C1orf30, KSHIIIC, HKSHIIIC Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Skeletal muscle
WB Suggested Anti-KCNC4 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-P, WB | |
Human, Monkey, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC, WB | |
Human, Monkey, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating