You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb575398 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to KCNA10 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Guinea pig, Mouse, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human KCNA10 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 56kDa |
Target | KCNA10 |
UniProt ID | Q16322 |
Protein Sequence | Synthetic peptide located within the following region: PANVPIDIFADEISFYELGSEAMDQFREDEGFIKDPETLLPTNDIHRQFW |
NCBI | NP_005540 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | Kcn1, Kv1.8 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Human kidney
WB Suggested Anti-KCNA10 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate.
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Canine, Gallus, Porcine, Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating