KAT5 Rabbit Polyclonal Antibody

• Catalog Number: orb576833
• Category: Antibodies
• Description: Rabbit polyclonal antibody to KAT5
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 53kDa
• Target: KAT5
• UniProt ID: Q92993
• Protein Sequence: Synthetic peptide located within the following region: LQYLNLINYYKGQYILTLSEDIVDGHERAMLKRLLRIDSKCLHFTPKDWS
• NCBI: NP_874368
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: TIP, ESA1, PLIP, TIP60, cPLA2, HTATIP, ZC2HC5, HTA
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Rabbit Anti-KAT5 Antibody, Catalog Number: orb576833, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

Rabbit Anti-KAT5 Antibody, Catalog Number: orb576833, Formalin Fixed Paraffin Embedded Tissue: Human Testis Tissue, Observed Staining: Cytoplasm in Leydig cells, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-KAT5 Antibody, Positive Control: Lane 1: 50 ug human RKO lysate, Primary Antibody Dilution: 1:500, Secondary Antibody: Goat anti-rabbit-Alexa Fluor 680, Secondry Antibody Dilution: 1:5000.

WB Suggested Anti-KAT5 Antibody, Titration: 1.0 ug/ml, Positive Control: HT1080 Whole Cell. There is BioGPS gene expression data showing that KAT5 is expressed in HT1080.