JMJD1A antibody

• Catalog Number: orb574439
• Category: Antibodies
• Description: Rabbit polyclonal antibody to JMJD1A
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human JMJD1A
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 147kDa
• Target: KDM3A
• UniProt ID: Q53S72
• Protein Sequence: Synthetic peptide located within the following region: HNLYSCIKVAEDFVSPEHVKHCFWLTQEFRYLSQTHTNHEDKLQVKNVIY
• NCBI: NP_060903
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: TSGA, JMJD1, JHDM2A, JHMD2A, JMJD1A
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Human kidney

Human Smooth Muscle

WB Suggested Anti-JMJD1A Antibody Titration: 1.0 ug/ml, Positive Control: Jurkat cell lysate, KDM3A is supported by BioGPS gene expression data to be expressed in Jurkat.