You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb324697 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Jdp2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat |
Reactivity | Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the n terminal region of mouse Jundm2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 19kDa |
Target | Jdp2 |
UniProt ID | P97875 |
Protein Sequence | Synthetic peptide located within the following region: MMPGQIPDPSVTAGSLPGLGPLTGLPSSALTTEELKYADIRNIGAMIAPL |
NCBI | NP_112149 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti Jdp2 antibody, anti Jundp2 antibody, anti TIF Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of mouse Heart tissue using Jdp2 antibody
WB Suggested Anti-Jundm2 Antibody Titration: 0.2-1 ug/mL, Positive Control: Mouse Heart.
FC, ICC, IHC, WB | |
Human, Mouse | |
Rabbit | |
Recombinant | |
Unconjugated |
FC, ICC, IHC, WB | |
Human, Mouse | |
Rabbit | |
Recombinant | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Rat | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating