You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb586005 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ITGAV |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Sheep |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human ITGAV |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 100kDa |
Target | ITGAV |
UniProt ID | E7EWZ6 |
Protein Sequence | Synthetic peptide located within the following region: PVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENG |
NCBI | NP_001138471 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | CD51, MSK8, VNRA, VTNR Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Mouse, Target Name: ITGAV, Sample Tissue: Mouse Heart, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target Name: ITGAV, Sample Tissue: Human 293T Whole Cell, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target Name: ITGAV, Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: ITGAV, Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.
WB Suggested Anti-ITGAV Antibody, Titration: 1.0 ug/ml, Positive Control: PANC1 Whole Cell.
FC, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IF, IHC, WB | |
Human | |
Mouse | |
Monoclonal | |
Unconjugated |
FC, WB | |
Bovine, Canine, Equine, Mouse, Porcine, Sheep | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating