You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb312127 |
---|---|
Category | Antibodies |
Description | Isocitrate dehydrogenase/IDH1 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, ICC, IF, IHC, IHC-Fr, WB |
Predicted Reactivity | Hamster |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human IDH1 (381-413aa KGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAK), different from the related mouse and rat sequences by one amino acid. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 46659 MW |
UniProt ID | O75874 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Isocitrate dehydrogenase [NADP] cytoplasmic;IDH;1. Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of HepG2 cells using anti-IDH1 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
WB analysis of IDH1 using anti-IDH1 antibody.Lane 1:Rat Lung Tissue;2:Rat Kidney Tissue;3:Rat Brain Tissue;4:HELA Cell;5:SMMC Cell;6:A549 Cell;7:NIH3T3 Cell.
IHC analysis of IDH1 using anti-IDH1 antibody.IDH1 was detected in paraffin-embedded section of Human Intestinal Cancer Tissue.
IHC analysis of IDH1 using anti-IDH1 antibody.IDH1 was detected in paraffin-embedded section of Mouse Testis Tissue.
IHC analysis of IDH1 using anti-IDH1 antibody.IDH1 was detected in paraffin-embedded section of Rat Testis Tissue.
IHC analysis of IDH1 using anti-IDH1 antibody.IDH1 was detected in frozen section of rat small intestine tissue.
IHC analysis of IDH1 using anti-IDH1 antibody.IDH1 was detected in immunocytochemical section of A549 cell.
IF, IHC-P | |
Human | |
Mouse | |
Monoclonal | |
Unconjugated |
IHC, WB | |
Canine, Human, Monkey, Mouse, Rat | |
Mouse | |
Monoclonal | |
Unconjugated |
IHC, WB | |
Canine, Human, Monkey, Mouse, Rat | |
Mouse | |
Monoclonal | |
Unconjugated |
IHC, WB | |
Canine, Human, Mouse, Rat | |
Mouse | |
Monoclonal | |
Unconjugated |
IF, WB | |
Human, Mouse, Rat | |
Mouse | |
Monoclonal | |
Unconjugated |
Filter by Rating