You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb584319 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ISG15 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Porcine, Rabbit, Sheep |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ISG15 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 17kDa |
Target | ISG15 |
UniProt ID | P05161 |
Protein Sequence | Synthetic peptide located within the following region: EPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGK |
NCBI | NP_005092 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | G1P2, IP17, UCRP, IFI15, IMD38, hUCRP Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Type: 1. Human NT-2 cells (60 ug), 2. mouse brain extracts (80 ug), Primary Antibody dilution: 2 ug/ml, Secondary Antibody: IRDye 800CW goat anti-rabbit, Secondary Antibody dilution: 1:20000.
Host: Rabbit, Target Name: ISG15, Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: ISG15, Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: ISG15, Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: ISG15, Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: ISG15, Sample Type: Human Hela, Antibody dilution: 1.0 ug/ml. ISG15 is supported by BioGPS gene expression data to be expressed in HeLa.
Host: Rabbit, Target Name: ISG15, Sample Type: Human MCF7, Antibody dilution: 1.0 ug/ml. ISG15 is supported by BioGPS gene expression data to be expressed in MCF7.
Application: IHC, Species+tissue/cell type: Mouse brain stem cells, Primary antibody dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary antibody dilution: 1:1000.
WB Suggested Anti-ISG15 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human kidney.
ELISA, FC, ICC, IF, IHC, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating