You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb326191 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Irgc1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rat |
Reactivity | Mouse |
Immunogen | The immunogen is a synthetic peptide corresponding to a region of Mouse |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 45kDa |
Target | Irgc1 |
UniProt ID | Q8C262 |
Protein Sequence | Synthetic peptide located within the following region: RGLGAEDPGAALTGVVETTMQPSPYPHPQFPDVTLWDLPGAGSPGCSADK |
NCBI | NP_950178 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti F630044M05Rik antibody, anti Gm1102 antibody, Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-Irgc1 Antibody, Titration: 1.0 ug/mL, Positive Control: Mouse Brain.
ELISA, ICC, IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Equine, Mouse, Porcine, Rabbit | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IF, IHC-Fr, IHC-P, WB | |
Bovine, Porcine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating