IRF7 Rabbit Polyclonal Antibody

• Catalog Number: orb576667
• Category: Antibodies
• Description: Rabbit polyclonal antibody to IRF7
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IRF7
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 54 kDa
• Target: IRF7
• UniProt ID: Q92985
• Protein Sequence: Synthetic peptide located within the following region: EPWLCRVHLEGTQREGVSSLDSSSLSLCLSSANSLYDDIECFLMELEQPA
• NCBI: NP_004022
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: IMD39, IRF-7, IRF7A, IRF7B, IRF7C, IRF7H, IRF-7H
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/ml of the antibody was used in this experiment. The protein may be modified by phosphorylation.

Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 0.5 ug/ml.

WB Suggested Anti-IRF7 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HT1080 cell lysate.