You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb315154 |
---|---|
Category | Antibodies |
Description | IRF5 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human IRF5 (442-472aa RLQISNPDLKDRMVEQFKELHHIWQSQQRLQ), different from the related mouse sequence by three amino acids. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 56044 MW |
UniProt ID | Q13568 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Interferon regulatory factor 5;IRF-5;IRF5; Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
WB analysis of IRF5 using anti-IRF5 antibody.Lane 1:Rat Intestine Tissue;2:HELA Cell;3:COLO320 Cell;4:NIH3T3 Cell;5:HEPA Cell.
IHC analysis of IRF5 using anti-IRF5 antibody. IRF5 was detected in a paraffin-embedded section of human mammary cancer tissue.
IHC analysis of IRF5 using anti-IRF5 antibody. IRF5 was detected in a paraffin-embedded section of mouse spleen tissue.
IHC analysis of IRF5 using anti-IRF5 antibody. IRF5 was detected in a paraffin-embedded section of rat spleen tissue.
Filter by Rating