You have no items in your shopping cart.
Cart summary
Item 1 of 1
Ip6k1 antibody
Catalog Number: orb331181
| Catalog Number | orb331181 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to Ip6k1 |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat |
| Reactivity | Mouse |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 49kDa |
| Target | Ip6k1 |
| UniProt ID | Q6PD10 |
| Protein Sequence | Synthetic peptide located within the following region: YPYVESETVEQDDTPEREQPRRKHSRRSLHRSGSGSDHKEEKASLSFETS |
| NCBI | NP_038813 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | anti 1200016D08Rik antibody, anti AU022776 antibod Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-Ip6k1 Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Heart.
- Item 1 of 3
inositol hexakisphosphate kinase 1 Antibody [orb556128]
ICC, IHC-P, IP, WB
Human, Mouse
Rabbit
Polyclonal
Unconjugated
100 μl - Item 1 of 3
- Item 1 of 2
- Item 1 of 2
- Item 1 of 1
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
