You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb331249 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Interferon gamma |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Guinea pig, Human, Mouse, Rabbit, Rat |
Reactivity | Guinea pig, Human, Mouse, Rat |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 42kDa |
Target | HCAR2 |
UniProt ID | Q8TDS4 |
Protein Sequence | Synthetic peptide located within the following region: YYFSSPSFPNFFSTLINRCLQRKMTGEPDNNRSTSVELTGDPNKTRGAPE |
NCBI | NP_808219 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | HCA2, HM74a, HM74b, PUMAG, NIACR1, Puma-g, GPR109A Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of MCF7 Whole Cell tissue using HCAR2 antibody
Host: Rabbit, Target Name: HCAR2, Sample Tissue: Human Stomach Tumor, Antibody dilution: 1.0 ug/ml.
WB Suggested Anti-HCAR2 Antibody, Titration: 1.0 ug/ml, Positive Control: MCF7 Whole Cell.
ICC, IF, IHC-P, WB | |
Rabbit | |
Polyclonal | |
Unconjugated |
FACS, ICC, IHC, IHC-Fr, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, ICC, IF, IHC-P, WB | |
Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating