Interferon gamma antibody

• Catalog Number: orb331249
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Interferon gamma
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Guinea pig, Human, Mouse, Rabbit, Rat
• Reactivity: Guinea pig, Human, Mouse, Rat
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 42kDa
• Target: HCAR2
• UniProt ID: Q8TDS4
• Protein Sequence: Synthetic peptide located within the following region: YYFSSPSFPNFFSTLINRCLQRKMTGEPDNNRSTSVELTGDPNKTRGAPE
• NCBI: NP_808219
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: HCA2, HM74a, HM74b, PUMAG, NIACR1, Puma-g, GPR109A
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of MCF7 Whole Cell tissue using HCAR2 antibody

Host: Rabbit, Target Name: HCAR2, Sample Tissue: Human Stomach Tumor, Antibody dilution: 1.0 ug/ml.

WB Suggested Anti-HCAR2 Antibody, Titration: 1.0 ug/ml, Positive Control: MCF7 Whole Cell.