You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb585494 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to iNOS |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Human |
Reactivity | Human |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 110kDa |
Target | NOS2 |
UniProt ID | P35228 |
Protein Sequence | Synthetic peptide located within the following region: PCATSSPVTQDDLQYHNLSKQQNESPQPLVETGKKSPESLVKLDATPLSS |
NCBI | EAW51048 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | NOS, INOS, NOS2A, HEP-NOS Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Lanes: Lane 1: 30 ug human placental tissue lysate, Lane 2: 30 ug human placental tissue lysate, Lane 3: 30 ug human placental tissue lysate, Lane 4: 30 ug human placental tissue lysate, Lane 5: 20 ug human myometrial tissue lysate, Primary Antibody dilution: 1:500, Secondary Antibody: Goat anti-rabbit HRP, Secondary Antibody dilution: 1:10000, Gene Name: Nitric oxide synthase 2, inducible (NOS2).
Rabbit Anti-NOS2 Antibody, Catalog Number: orb585494, Formalin Fixed Paraffin Embedded Tissue: Human Appendix (Colon) Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
Application: Western blotting, Species+tissue/cell type: Human placental and myometrial tissue lysate, How many ug'sof tissue/cell lysate run on the gel: 1: 50 ug human placental tissue lysate, 2: 40 ug human placental tissue lysate, 3: 30 ug human placental tissue lysate, 4: 20 ug human placental tissue lysate, 5: 10 ug human placental tissue lysate, 6: 20 ug human myometrial tissue lysate, Primary antibody dilution: 1:500, Secondary Antibody: Goat anti-rabbit HRP, Secondary antibody dilution: 1:10000.
Sample Type: Human placental tissue, Primary Antibody dilution: 1:50, Secondary Antibody: Goat anti rabbit-HRP, Secondary Antibody dilution: 1:10000, Color/Signal Descriptions: Brown: NOS2 Purple: Haemotoxylin, Gene Name: NOS2.
WB Suggested Anti-NOS2 Antibody, Titration: 1.0 ug/ml, Positive Control: Jurkat Whole Cell.
ELISA, ICC, IF, IHC-P | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC, WB | |
Human, Mouse, Rabbit | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating