IMPDH2 antibody

• Catalog Number: orb330749
• Category: Antibodies
• Description: Rabbit polyclonal antibody to IMPDH2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IMPDH2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 56 kDa
• Target: IMPDH2
• UniProt ID: P12268
• Protein Sequence: Synthetic peptide located within the following region: MADYLISGGTSYVPDDGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVD
• NCBI: NP_000875
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti IMPD2 antibody, anti IMPDH-II antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: IMPDH2, Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 3 ug/ml.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The protein may be modified by glycosylation and phosphorylation.

Sample Type: Human Hep-2 cells, Primary Antibody dilution: 1:500, Secondary Antibody: Goat anti-rabbit-Alexa Fluor 568, Secondary Antibody dilution: 1:400, Color/Signal Descriptions: Red: IMPDH2 Blue: DAPI, Gene Name: IMPDH2.

WB Suggested Anti-IMPDH2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 721_B cell lysate, IMPDH2 is supported by BioGPS gene expression data to be expressed in 721_B.