You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb582303 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to IMPDH1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human IMPDH1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 55 kDa |
Target | IMPDH1 |
UniProt ID | P20839 |
Protein Sequence | Synthetic peptide located within the following region: KKGKLPIVNDCDELVAIIARTDLKKNRDYPLASKDSQKQLLCGAAVGTRE |
NCBI | NP_899066 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | IMPD, RP10, IMPD1, LCA11, IMPDH-I, sWSS2608 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Protein may be modified by phosphorylation, and multiple isoforms of this protein in the range of 42 kDa to 68 kDa contain the peptide sequence.
Human Pancreas
Immunohistochemistry with Human Colon lysate tissue at an antibody concentration of 5.0 ug/ml using anti-IMPDH1 antibody (orb582303).
WB Suggested Anti-IMPDH1 Antibody Titration: 1 ug/ml, Positive Control: Hela cell lysate. IMPDH1 is supported by BioGPS gene expression data to be expressed in HeLa.
ELISA, FC, ICC, IF, IHC, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-P, WB | |
Bovine, Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating