ILF3 antibody

• Catalog Number: orb576912
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ILF3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Zebrafish
• Reactivity: Human, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ILF3
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 95kDa
• Target: ILF3
• UniProt ID: Q12906
• Protein Sequence: Synthetic peptide located within the following region: IFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKG
• NCBI: NP_004507
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CBTF, DRBF, MMP4, MPP4, NF90, NFAR, NF110, NF90a,
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: ILF3, Sample Tissue: Human Stomach Tumor, Antibody Dilution: 1.0 ug/ml.

Human Lung

Rabbit Anti-ILF3 Antibody, Catalog Number: orb576912, Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue, Observed Staining: Cytoplasmic and nuclear in pinealocytes, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-ILF3 Antibody, Titration: 1 ug/ml, Positive Control: Rat tissue.

WB Suggested Anti-ILF3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: K562 cell lysate. ILF3 is strongly supported by BioGPS gene expression data to be expressed in Human K562 cells.