You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2056083 |
---|---|
Category | Proteins |
Description | ILDR2 Recombinant Protein |
Species/Host | Human |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 23.1 kDa |
UniProt ID | Q71H61 |
Protein Sequence | MDRVLLRWISLFWLTAMVEGLQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRGREITIVHDADLQIGKLMWGDSGLYYCIITTPDDLEGKNEDSVELLVLGRTGLLADLLPSFAVEIMPE |
Source | Yeast |
NCBI | NP_955383.1 |
Storage | -20°C or -80°C |
Buffer/Preservatives | Liquid or Lyophilized powder |
Alternative names | angulin-3;C1orf32;dJ782G3.1;immunoglobulin-like do Read more... |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
WB | |
> 95% as determined by SDS-PAGE. | |
45.1 kDa | |
HEK293 cells |
Greater than 90% as determined by SDS-PAGE. | |
23.1 kDa | |
Yeast |
Greater than 90% as determined by SDS-PAGE. | |
48.1 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
23.1 kDa | |
Yeast |
Filter by Rating