You have no items in your shopping cart.
Cart summary
ILDR2 Recombinant Protein
Catalog Number: orb2056082
| Catalog Number | orb2056082 |
|---|---|
| Category | Proteins |
| Description | ILDR2 Recombinant Protein |
| Species/Host | Human |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 23.1 kDa |
| UniProt ID | Q71H61 |
| Protein Sequence | MDRVLLRWISLFWLTAMVEGLQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRGREITIVHDADLQIGKLMWGDSGLYYCIITTPDDLEGKNEDSVELLVLGRTGLLADLLPSFAVEIMPE |
| Source | Yeast |
| NCBI | NP_955383.1 |
| Storage | -20°C or -80°C |
| Buffer/Preservatives | Liquid or Lyophilized powder |
| Alternative names | angulin-3;C1orf32;dJ782G3.1;immunoglobulin-like do Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 1
ILDR2 Recombinant Protein [orb1231476]
WB
> 95% as determined by SDS-PAGE.
45.1 kDa
HEK293 cells
0.1 mg Human ILDR2 protein [orb246173]
Greater than 90% as determined by SDS-PAGE.
23.1 kDa
Yeast
20 μg, 100 μg, 500 μg, 1 mgHuman ILDR2 protein [orb244862]
Greater than 90% as determined by SDS-PAGE.
48.1 kDa
E.coli
20 μg, 100 μg, 1 mgILDR2 Recombinant Protein [orb2056083]
Greater than 90% as determined by SDS-PAGE.
23.1 kDa
Yeast
20 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
