IL6 antibody

• Catalog Number: orb579132
• Category: Antibodies
• Description: Rabbit polyclonal antibody to IL6
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HGF
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 83 kDa
• Target: HGF
• UniProt ID: P14210
• Protein Sequence: Synthetic peptide located within the following region: VKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIP
• NCBI: NP_001010932
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: SF, HGFB, HPTA, F-TCF, DFNB39
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Mouse whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/ml of the antibody was used in this experiment. Protein is processed to yield 51 kDa alpha chain.

Formalin Fixed Paraffin Embedded Tissue: human liver cancer, Primary antibody concentration: 7 ug/ml, Incubation with primary antibodies: overnight at 4°C, Detections: Avidin-Biotin-HRP with NovaRed (Vector Labs) substrate. Counterstain: Hematoxylin.

Formalin Fixed Paraffin Embedded Tissue: normal human kidney, Primary antibody concentration: 7 ug/ml, Incubation with primary antibodies: overnight at 4°C, Detections: Avidin-Biotin-HRP with NovaRed (Vector Labs) substrate. Counterstain: Hematoxylin.

Formalin Fixed Paraffin Embedded Tissue: normal human liver, Primary antibody concentration: 7 ug/ml, Incubation with primary antibodies: overnight at 4°C, Detections: Avidin-Biotin-HRP with NovaRed (Vector Labs) substrate. Counterstain: Hematoxylin.

Host: Rabbit, Target Name: HGF, Sample Tissue: Human HepG2, Antibody Dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: HGF, Sample Tissue: Human MCF7 Whole Cell, Antibody Dilution: 1 ug/ml.

Host: Rabbit, Target Name: HGF, Sample Tissue: Human OVCAR-3 Whole Cell, Antibody Dilution: 3 ug/ml.

Host: Rabbit, Target Name: HGF, Sample Type: 293T Whole Cell lysates, Antibody Dilution: 0.2 ug/ml.

Host: Rabbit, Target Name: HGF, Sample Type: 293T Whole Cell lysates, Antibody Dilution: 0.2 ug/ml.

Host: Rabbit, Target Name: HGF, Sample Type: 721_B Cell lysates, Antibody Dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: HGF, Sample Type: 721_B Whole Cell lysates, Antibody Dilution: 0.5 ug/ml.

Host: Rabbit, Target Name: HGF, Sample Type: Human HepG2 cell, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5.0 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 12%.

Host: Rabbit, Target: HGF, Positive control (+): Human Placenta (PL), Negative control (-): Human heart (HE), Antibody concentration: 1 ug/ml.

Immunohistochemistry with Human Adrenal Gland lysate tissue at an antibody concentration of 5.0 ug/ml using anti-HGF antibody (orb579132).

WB Suggested Anti-HGF Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 293T cell lysate. There is BioGPS gene expression data showing that HGF is expressed in HEK293T.