IL33 Rabbit Polyclonal Antibody

• Catalog Number: orb581287
• Category: Antibodies
• Description: Rabbit polyclonal antibody to IL33
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Human
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IL33
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 31kDa
• Target: IL33
• UniProt ID: O95760
• Protein Sequence: Synthetic peptide located within the following region: AKEVCPMYFMKLRSGLMIKKEACYFRRETTKRPSLKTGRKHKRHLVLAAC
• NCBI: NP_254274
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: DVS27, IL1F11, NF-HEV, NFEHEV, C9orf26
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Positive control (+): Human Brain (BR), Negative control (-): HepG2 Cell Lysate (HG), Antibody concentration: 2 ug/ml.

Skin

WB Suggested Anti-IL33 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 293T cell lysate.