You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb584780 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to IL32 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Human |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human IL32 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 27 kDa |
Target | IL32 |
UniProt ID | P24001 |
Protein Sequence | Synthetic peptide located within the following region: TPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKVMRWFQAMLQRL |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | NK4, TAIF, TAIFa, TAIFb, TAIFc, TAIFd, IL-32beta, Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.
Host: Rabbit, Target Name: IL32, Sample Tissue: Human 293T Whole Cell, Antibody dilution: 3 ug/ml.
Host: Rabbit, Target Name: IL32, Sample Tissue: Human Hela Whole Cell, Antibody dilution: 3 ug/ml.
Host: Rabbit, Target Name: IL32, Sample Tissue: Human HT1080 Whole Cell, Antibody dilution: 3 ug/ml.
Host: Rabbit, Target Name: IL32, Sample Type: Jurkat Whole cell lysates, Antibody dilution: 1.0 ug/ml.
Filter by Rating