You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb586073 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to IL26 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Canine |
Reactivity | Human |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 20 kDa |
Target | IL26 |
UniProt ID | Q9NPH9 |
Protein Sequence | Synthetic peptide located within the following region: LVTLSLAIAKHKQSSFTKSCYPRGTLSQAVDALYIKAAWLKATIPEDRIK |
NCBI | NP_060872 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | AK155, IL-26 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.
Host: Rabbit, Target Name: IL26, Sample Tissue: Human ACHN Whole Cell, Antibody dilution: 5 ug/ml.
Host: Rabbit, Target Name: IL26, Sample Tissue: Human HCT116 Whole Cell, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target Name: IL26, Sample Tissue: Human U937 Whole Cell, Antibody dilution: 1 ug/ml.
WB Suggested Anti-IL26 Antibody, Titration: 1.0 ug/ml, Positive Control: Hela Whole Cell.
Filter by Rating