You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb580768 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to IL22 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Sheep |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human IL22 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 20 kDa |
Target | IL22 |
UniProt ID | Q9GZX6 |
Protein Sequence | Synthetic peptide located within the following region: CHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI |
NCBI | NP_065386 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | TIFa, IL-21, IL-22, ILTIF, IL-TIF, IL-D110, zcyto1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 10-20% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The protein may be modified by glycosylation.
WB Suggested Anti-IL22 Antibody Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.
ELISA, ICC, IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC-P, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating