IL17F purified MaxPab mouse polyclonal antibody (B01P)

• Catalog Number: orb2290707
• Category: Antibodies
• Description: Mouse polyclonal antibody raised against a full-length human IL17F protein.
• Species/Host: Mouse
• Clonality: Polyclonal
• Tested applications: IHC-P, WB
• Reactivity: Human
• Immunogen: IL17F (NP_443104.1, 1 a.a. ~ 163 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MTVKTLHGPAMVKYLLLSILGLAFLSEAAARKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ
• NCBI: NP_443104.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunoperoxidase of purified MaxPab antibody to IL17F on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]

Western Blot analysis of IL17F expression in transfected 293T cell line by IL17F MaxPab polyclonal antibody. Lane 1: IL17F transfected lysate(17.93 KDa). Lane 2: Non-transfected lysate.