You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb329679 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to IKBKB |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human IKBKB |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 86kDa |
Target | IKBKB |
UniProt ID | O14920 |
Protein Sequence | Synthetic peptide located within the following region: CITGFRPFLPNWQPVQWHSKVRQKSEVDIVVSEDLNGTVKFSSSLPYPNN |
NCBI | NP_001547 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti FLJ40509 antibody, anti IKK-beta antibody, an Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: IKBKB, Sample Type: Human 721_B, Antibody Dilution: 1.0 ug/mL, IKBKB is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.
Application: Western blotting Species+tissue/cell type: Lane 1: 100 ug mouse liver lysate, Lane 2: 100 ug mouse brain lysate, Lane 3: 100 ug mouse heart lysate, Lane 4: 100 ug mouse kidney lysate, Lane 5: 100 ug mouse lung lysate, Lane 6: 100 ug mouse thymus lysate, Lane 7: 100 ug mouse spleen lysate, Lane 8: 100 ug mouse testis lysate, Lane 9: 100 ug HeLa cell lysate, Primary antibody Dilution: 1:1000, Secondary antibody:Anti-rabbit-AP, Secondary antibody Dilution: 1:10000.
Sample Type: Primary vascular endothelial cells. Protocol: Loaded 30 ug of cell lysate of each. One normal, one cultured with high glucose (which enhances IKK Beta). Expected band is cut. 10% Gel concentration.Primary Dilution: 1:1000.
WB Suggested Anti-IKBKB Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Human brain.
FC, ICC, IF, IHC, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC-P, WB | |
Human, Monkey, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating