Ikaros/IKZF1 Antibody (monoclonal, 5F12H7)

• Catalog Number: orb1474882
• Category: Antibodies
• Description: Ikaros/IKZF1 Antibody (monoclonal, 5F12H7)
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 5F12H7
• Tested applications: WB
• Reactivity: Human
• Isotype: IgG1
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Ikaros (428-459aa LKEEHRAYDLLRAASENSQDALRVVSTSGEQM), different from the related mouse sequence by five amino acids.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 55-65 kDa
• UniProt ID: Q13422
• Storage: At -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freezing and thawing.
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Expiration Date: 12 months from date of receipt.

Western blot analysis of Ikaros/IKZF1 using anti-Ikaros/IKZF1 antibody.