You have no items in your shopping cart.
Cart summary
Item 1 of 1
Ik antibody
Catalog Number: orb581337
| Catalog Number | orb581337 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to Ik |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish |
| Reactivity | Mouse |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Ik |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 65kDa |
| Target | Ik |
| UniProt ID | Q9Z1M8 |
| Protein Sequence | Synthetic peptide located within the following region: GIKMSEGRKTRRFKETNDKAELDRQWKKISAIIEKRKRMEADGVEVKRPK |
| NCBI | NP_036009 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | MuRE, MuRED Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: Ik, Sample Type: Mouse Testis lysates, Antibody dilution: 1.0 ug/ml.
- Item 1 of 8
- Item 1 of 4
- Item 1 of 3
- Item 1 of 3
- Item 1 of 2
IK antibody [orb214090]
IH, WB
Human, Mouse, Primate, Rat
Rabbit
Polyclonal
Unconjugated
200 μl, 100 μl, 30 μl
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
