You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579539 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to IGFBP4 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Sheep |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human IGFBP4 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 28kDa |
Target | IGFBP4 |
UniProt ID | P22692 |
Protein Sequence | Synthetic peptide located within the following region: RALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCV |
NCBI | NP_001543 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | BP-4, IBP4, IGFBP-4, HT29-IGFBP Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Mouse, Target Name: IGFBP4, Sample Tissue: Mouse Brain, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target Name: IGFBP4, Sample Tissue: Human HT1080 Whole Cell, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target Name: IGFBP4, Sample Tissue: Human MDA-MB-435s Whole Cell, Antibody dilution: 1 ug/ml.
Immunohistochemistry with Human Prostate lysate tissue at an antibody concentration of 5.0 ug/ml using anti-IGFBP4 antibody (orb579539).
WB Suggested Anti-IGFBP4 Antibody Titration: 1 ug/ml, Positive Control: Fetal Brain Lysate.
ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating