IGF2BP2 antibody

• Catalog Number: orb330141
• Category: Antibodies
• Description: Rabbit polyclonal antibody to IGF2BP2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Rat, Yeast
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IGF2BP2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 66kDa
• Target: IGF2BP2
• UniProt ID: Q9Y6M1
• Protein Sequence: Synthetic peptide located within the following region: QANLIPGLNLSALGIFSTGLSVLSPPAGPRGAPPAAPYHPFTTHSGYFSS
• NCBI: NP_006539
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: Anti-A170 antibody, anti-EBI 3 associated protein
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of human Fetal Liver tissue using IGF2BP2 antibody

Western blot analysis of human Fetal Lung tissue using IGF2BP2 antibody

Western blot analysis of human Placenta tissue using IGF2BP2 antibody

Western blot analysis of HT1080 cell lysate tissue using IGF2BP2 antibody

Western blot analysis of human Placenta tissue using IGF2BP2 antibody

Western blot analysis of human Fetal Heart tissue using IGF2BP2 antibody

Host: Rabbit, Target Name: IGF2BP2, Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL.

Host: Rabbit, Target Name: IGF2BP2, Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL.

Host: Rabbit, Target Name: IGF2BP2, Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.

Host: Rabbit, Target Name: IGF2BP2, Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.

Host: Rabbit, Target Name: IGF2BP2, Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL.

WB Suggested Anti-IGF2BP2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: HT1080 cell lysate, IGF2BP2 is supported by BioGPS gene expression data to be expressed in HT1080.