IGF2BP1 antibody

• Catalog Number: orb330971
• Category: Antibodies
• Description: Rabbit polyclonal antibody to IGF2BP1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Rat, Sheep, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IGF2BP1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 63 kDa
• Target: IGF2BP1
• UniProt ID: Q9NZI8
• Protein Sequence: Synthetic peptide located within the following region: AFVDCPDEHWAMKAIETFSGKVELQGKRLEIEHSVPKKQRSRKIQIRNIPP
• NCBI: NP_006537
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti CRD-BP antibody, anti CRDBP antibody, anti IM
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunohistochemical staining of human lung carcinoma tissue using IGF2BP1 antibody

Western blot analysis of Jurkat cell lysate tissue using IGF2BP1 antibody

Immunohistochemical staining of human small intestine tissue using IGF2BP1 antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Protein may be phosphorylated.

Host: Mouse, Target Name: IGF2BP1, Sample Tissue: Mouse Pancreas, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target Name: IGF2BP1, Sample Tissue: Human 721_B, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: IGF2BP1, Sample Tissue: Human A549 Whole Cell, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target Name: IGF2BP1, Sample Tissue: Human THP-1 Whole Cell, Antibody dilution: 3 ug/ml.

Host: Rabbit, Target Name: IGF2BP1, Sample Tissue: Mouse Pancreas, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target: IGF2BP1, Positive control (+): 293T (2T), Negative control (-): Human liver (LI), Antibody concentration: 1 ug/ml.

Application: IHC, Species+tissue/cell type: Human small intestine, Primary antibody dilution: 1:300, Secondary antibody: Anti-rabbit-linker, Fbex-HRP.

Sample Type: Human lung carcinoma, Primary Antibody dilution: 1:300, Secondary Antibody: Anti-rabbit-linker, Fbex-HRP, Secondary Antibody dilution: NOT FOUND, Color/Signal Descriptions: Brown: IGFBP1 Blue: Nuclei, Gene Name: IGF2BP1.

WB Suggested Anti-IGF2BP1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate.